PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004752
Common NameRCOM_1082510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 584aa    MW: 65583.9 Da    PI: 5.4081
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004752genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.86.9e-25198251155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k+r++W+ +LH++Fv+av+q+ G++k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  29929.m004752 198 KARVVWSVDLHQKFVKAVNQI-GPDKVGPKKILDLMNVPWLTRENVASHLQKYRL 251
                    68*******************.********************************8 PP

2Response_reg79.61.1e-26191271109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl+vdD+p+ +++l+++l+k  y ev+++  +++al ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga
  29929.m004752  19 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLARDALYLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQHGA 112
                    89*********************.***************999999**********************6644.8*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ ++el++
  29929.m004752 113 CDYLLKPIRMKELRN 127
                    ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.1E-1461541IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.7E-4416140No hitNo description
SuperFamilySSF521724.98E-3516145IPR011006CheY-like superfamily
SMARTSM004481.0E-3117129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.82418133IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.7E-2419128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.26E-3020133No hitNo description
SuperFamilySSF466895.02E-17195255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27196256IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-21198251IPR006447Myb domain, plants
PfamPF002491.1E-7200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MENGFSSPRS DAFPAGLRVL VVDDDPTWLK ILEKMLKKCS YEVTTCGLAR DALYLLRERK  60
DGYDIVISDV NMPDMDGFKL LEHVGLEMDL PVIMMSVDGE TSRVMKGVQH GACDYLLKPI  120
RMKELRNIWQ HVFRKKIHEV RDIEILEGME SIQMARIGSD HSDDGYLFCG EDLTSVKKRK  180
DIENKHDDKD GESSTTKKAR VVWSVDLHQK FVKAVNQIGP DKVGPKKILD LMNVPWLTRE  240
NVASHLQKYR LYLSRLQKEN DSKTSIGGIK QSESSLGESA GSFGTQNSIN MQQKDVSNGN  300
YGFSGNSLFV QNTEPRNHES EKKGIVLKNA AESRRALTVD IPETRKSRSS QVEFGHSFIS  360
TASEVNFGAI GSSFPTQYSW CEIPQIQMKQ EPKPLQLDDG FNKLQLPGQQ QHIQADYPQP  420
VPPVISGSSI TERDIDGPKI KPLYESKQNA SHVTSTGGAI DSSHIQTKTF VPNNQVFEPN  480
CTSTSTIKNQ GFNPNCISDV ESAQKSVNWG MSPLDDDFQV CWFQGDYYAM NVGRQNIELP  540
ENYDPGLIAD VPTHLYDAVR FDCDSTLLYD LTEYSLVEQG LFIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17194256163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515016.20.0PREDICTED: two-component response regulator ARR11
TrEMBLB9RMP70.0B9RMP7_RICCO; Two-component sensor histidine kinase bacteria, putative
STRINGPOPTR_0008s18130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-140response regulator 11